PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr004632.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 240aa    MW: 26529.7 Da    PI: 8.3772
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr004632.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB164.31.6e-5123118297
        NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  +eqd++lPianv+rimk++lP nakisk+aket+qec+sefisfvt+eas+kc++e+rkt+ngdd++wal+ lGf+dy  pl+ yl++yre e+++
  Pbr004632.1  23 KEQDQLLPIANVGRIMKQILPPNAKISKEAKETMQECASEFISFVTGEASEKCRKERRKTVNGDDVCWALGALGFDDYTGPLRRYLHRYREQERDR 118
                  89*******************************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-4821125IPR009072Histone-fold
SuperFamilySSF471131.02E-3725139IPR009072Histone-fold
PfamPF008081.5E-262892IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.8E-155674No hitNo description
PROSITE patternPS0068505975IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.8E-157593No hitNo description
PRINTSPR006154.8E-1594112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MVDNNNPGAS GAAKDDDIDG GIKEQDQLLP IANVGRIMKQ ILPPNAKISK EAKETMQECA  60
SEFISFVTGE ASEKCRKERR KTVNGDDVCW ALGALGFDDY TGPLRRYLHR YREQERDRIS  120
SEANNNINED HQRISINNIP HTQGSNYFKG SSTSGSQIIH PHRCLQTSSD AVALLSFKSQ  180
ANLNNKLLYT SCPSTPSLHP PASPHLRCRR VVLPSFSLRG SFPPDTLSRL DQLRSSPPQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B7e-4122113192Transcription factor HapC (Eurofung)
4g92_B7e-4122113192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349502.11e-113PREDICTED: nuclear transcription factor Y subunit B-4-like
TrEMBLM5XH852e-69M5XH85_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s22520.12e-64(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.15e-53nuclear factor Y, subunit B5